Clinical and Diagnostic Laboratory Immunology, March 1999, p. 279-281, Vol. 6, No. 2
1071-412X/99/$04.00+0
Copyright © 1999, American Society for Microbiology. All rights reserved.
Restricted Isotypic Antibody Reactivity to
Hepatitis C Virus Synthetic Peptides in Immunocompromised
Patients
Marisol
Devesa,1
Arlette
de Saez,2
Graciela
León,2
Firelei
Sirit,3
Clarisa
Cosson,1
Henry
Bermúdez,4
Ferdinando
Liprandi,1
Oscar
Noya,4 and
Flor H.
Pujol1,*
Laboratorio de Biología de Virus,
Centro de Microbiología y Biología
Celular,1 and Planta Procesadora de
Derivados Sanguíneos, Quimbiotec,3
Instituto Venezolano de Investigaciones Científicas,
Banco Municipal de Sangre,2 and
Laboratorio de Síntesis de Péptidos,
Sección de Biohelmintiasis, Instituto de Medicina Tropical,
Universidad Central de Venezuela,4 Caracas,
Venezuela
Received 18 September 1998/Returned for modification 23 November
1998/Accepted 28 December 1998
 |
ABSTRACT |
An enzyme immunoassay based on three synthetic peptides from the
core, NS4, and NS5 regions of hepatitis C virus allowed the detection
of antibodies in 100% of immunocompetent infected patients and in 91%
of immunocompromised patients (hemodialysis and hemophiliac patients).
Immune impairment seemed to restrict the spectrum of antibody isotypes
reacting to the core peptide.
 |
TEXT |
Synthetic peptides have proven to be
valuable tools for immunodiagnosis of hepatitis C virus (HCV) infection
(8, 10, 18). Most of the available serological tests for HCV
are based on the combined use of synthetic peptides and recombinant
proteins. In a previous study, restricted antibody reactivity to HCV
peptides was observed in HCV-infected hemodialysis patients, although
some immunodominant epitopes in the core and NS4 regions were still consistently recognized (5). The aim of this study was to
design an immunodiagnostic system for HCV based exclusively on
synthetic peptides and suitable for epidemiological studies. In
addition, isotypic antibody reactivity to these peptides was evaluated
and compared between immunocompromised and immunocompetent HCV-infected patients.
A total of 105 sera from HCV-infected hemodialysis patients previously
tested for viral hepatitis serological markers (16) were
used in this study. Hemophiliac patient sera (24 hemophilia A patients)
were also tested. Both hemophiliac and hemodialysis patients were
defined as immunocompromised HCV-infected patients in this study.
HCV-positive blood donors and other HCV-infected patients (n = 66) without any evident cause of immunosuppression were also
included. Information about the genotypes of HCV circulating in 51 of
these patients (17) was available: genotypes 1a, 1b, 2a, 2b,
3a, and 4 (14, 15, 8, 6, 1, and 1 patients, respectively) and six mixed
infections were present in the patients analyzed. All patients were
human immunodeficiency virus (HIV) negative except for one hemophiliac
patient. A total of 96 sera from blood donors, negative for hepatitis B
virus (HBV), HCV, and HIV markers, were also tested.
Core peptides (716 [20-mer], RNTYRRPQDVKFPGGGQIVG [amino
acids {aa} 13 to 32]; 286 [40-mer],
STNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRG [aa 2 to 41]), NS4 peptides (59 [20-mer],
AFASRGNHVSPTHYVPESDA [aa 1920 to 1941]),
and NS5 peptides (290 [35-mer],
RKFPPALPIWARPDYNPPLLESWKDPDYVPPVVHG [aa 2279 to 2313])
were manually synthesized (9, 13) and were based on the
consensus sequence of the HCV database (14). The
immunodominant antigenic region NS3f (2) was modeled with long peptides (aa 1359 to 1408, 50-mer; aa 1409 to 1448, 40-mer; aa
1449 to 1488, 40-mer), but no significant reactivity was obtained (data
not shown). All peptides were synthesized as monomers and polymers, as
previously described (15).
Antibody reactivity to the peptides was tested by enzyme immunoassay,
as previously described (5). Whether tested singly or as a
mixture, 1 µg of each peptide was adsorbed to wells. Human sera were
tested at a 1/40 dilution in 1% skim milk in phosphate-buffered saline
by using for detection a 10
5 dilution of
peroxidase-labelled goat anti-human immunoglobulin G (IgG) (Kirkegaard
& Perry Laboratories, Gaithersburg, Md.) in the same buffer.
Subclass-specific antibodies to each peptide were tested at the same
serum dilution by using anti-isotype-specific monoclonal antibodies
conjugated to biotin (Sigma Chemical Co., St. Louis, Mo.), each at a
pretested optimal dilution, and streptavidin-peroxidase (1/1,000)
(Sigma). TMB (3,3',5,5'-tetramethylbenzidine) (Bio-Rad Laboratories)
was used as a substrate. Cutoff values were determined as means of
negative serum values plus 3 standard deviations. Statistical
differences were evaluated by the chi square and/or Fisher exact test
with Yates' correction, according to a computerized Epi Info program,
version 5.01b (Centers for Disease Control and Prevention, Atlanta,
Ga.). Average statistical differences were evaluated by the Student
t test.
The antibody reactivity to a 40-mer peptide (peptide 286) designed from
the N-terminal region of the HCV core protein was significantly higher
than that directed to a 20-mer peptide (peptide 716) derived from a
region located inside the 40-mer peptide and previously found to be the
most frequently recognized in this region (5). Of 35 hemodialysis patient sera tested, 31 (89%) recognized peptide 286 while only 24 (69%) reacted with peptide 716, and a significantly
higher optical density (OD) was observed for 14 patients with peptide
286 (Table 1). The use of longer peptides
in the core region has previously been suggested by others to be more
effective (21). In the region shared by the two peptides, an
amino acid change was introduced in the 40-mer peptide, 286, since it
was more frequently found in the sequences of the different HCV
isolates; this may have contributed to the increased reactivity observed with peptide 286. The length and conservation of peptide 286 ensured appropriate reactivity of sera of patients infected with all of
the genotypes tested in this study (data not shown).
No significant increase in reactivity was detected by using polymeric
peptides instead of monomers (data not shown). When a mixture of
peptides 286, 59, and 290, derived from the core, NS4, and NS5,
respectively, was evaluated as a potential diagnostic antigen for HCV
infection, high sensitivity and specificity were obtained with
immunocompetent patients (66 of 66 patients recognized [100%] and 1 of 96 reactive among negative patient sera [99% specificity]). The
mixture, however, was recognized by only 91% of the immunocompromised HCV-infected patients (118 of 129). The presence of an NS3 antigen in
the cocktail used may be critical for adequate recognition of this
particular group of patients (3-5). Nevertheless, the peptide cocktail analyzed in this study seems to be useful for epidemiological studies in the general population.
The NS5 region was included, as it has been suggested that the use of
NS5 antigens may add sensitivity to diagnostic tests (20).
In fact, some HCV-infected hemodialysis patient sera from the group
studied by Devesa et al. (5) reacted only with peptide 232 from the NS5 region, which is comprised in peptide 290 used in this
study (data not shown). A small portion of the 290 peptide is well
conserved among different HCV isolates (aa 2288 to 2297). This might
explain the frequent recognition of peptide 290 by the sera of patients
tested in this study, irrespective of the infecting genotype (data not shown).
The 20-mer peptide derived from NS4 (peptide 59) and included in the
cocktail contains a sequence highly conserved among different HCV
isolates, which might be one of the reasons for its high frequency of
recognition (5, 10, 11). Antibodies against peptide 59 seem
to be raised at early stages of infection, with some degree of
antigenic cross-reactivity with proteins from different origins (24). In our study, the use of peptide 59 in the cocktail
did not produce nonspecific reactions. The only false-positive result was due to recognition of the core peptide, where some nonspecific reaction has also been described (23).
The antibody subclass reactivity was assayed for each of the three
peptides from the core, NS4, and NS5. For the latter two peptides, the
isotypic reactivity was mostly of the IgG1 subtype, a reactivity
similar to that observed in region NS4a (20, 25). No
significant differences were found in the isotypic reactivities between
immunocompetent and immunocompromised patients (data not shown). Only
in two hemodialysis patient sera was the highest reactivity, to both
NS4 and NS5 peptides, of the IgG3 subclass (data not shown).
For the core peptide, IgG1 reactivity was observed in all patients.
Antibodies of IgG3, IgG4, and/or IgA were found in 44% of
immunocompetent HCV-infected patients but in significantly fewer
immunocompromised patients, particularly in HBV-infected patients
(Table 2). Reactivity to the core region
has previously been shown to be predominantly by IgG1 antibodies,
although all other isotypes, particularly IgG3, have been detected
(6, 19, 22). A similar pattern was found for the 40-mer
peptide 286, although IgG3 and IgG4 were present at similar frequencies
(Table 2).