This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow E-mail this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Devesa, M.
Right arrow Articles by Pujol, F. H.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Devesa, M.
Right arrow Articles by Pujol, F. H.

 Previous Article  |  Next Article 

Clinical and Diagnostic Laboratory Immunology, March 1999, p. 279-281, Vol. 6, No. 2
1071-412X/99/$04.00+0
Copyright © 1999, American Society for Microbiology. All rights reserved.

Restricted Isotypic Antibody Reactivity to Hepatitis C Virus Synthetic Peptides in Immunocompromised Patients

Marisol Devesa,1 Arlette de Saez,2 Graciela León,2 Firelei Sirit,3 Clarisa Cosson,1 Henry Bermúdez,4 Ferdinando Liprandi,1 Oscar Noya,4 and Flor H. Pujol1,*

Laboratorio de Biología de Virus, Centro de Microbiología y Biología Celular,1 and Planta Procesadora de Derivados Sanguíneos, Quimbiotec,3 Instituto Venezolano de Investigaciones Científicas, Banco Municipal de Sangre,2 and Laboratorio de Síntesis de Péptidos, Sección de Biohelmintiasis, Instituto de Medicina Tropical, Universidad Central de Venezuela,4 Caracas, Venezuela

Received 18 September 1998/Returned for modification 23 November 1998/Accepted 28 December 1998


    ABSTRACT
Top
Abstract
Text
References

An enzyme immunoassay based on three synthetic peptides from the core, NS4, and NS5 regions of hepatitis C virus allowed the detection of antibodies in 100% of immunocompetent infected patients and in 91% of immunocompromised patients (hemodialysis and hemophiliac patients). Immune impairment seemed to restrict the spectrum of antibody isotypes reacting to the core peptide.


    TEXT
Top
Abstract
Text
References

Synthetic peptides have proven to be valuable tools for immunodiagnosis of hepatitis C virus (HCV) infection (8, 10, 18). Most of the available serological tests for HCV are based on the combined use of synthetic peptides and recombinant proteins. In a previous study, restricted antibody reactivity to HCV peptides was observed in HCV-infected hemodialysis patients, although some immunodominant epitopes in the core and NS4 regions were still consistently recognized (5). The aim of this study was to design an immunodiagnostic system for HCV based exclusively on synthetic peptides and suitable for epidemiological studies. In addition, isotypic antibody reactivity to these peptides was evaluated and compared between immunocompromised and immunocompetent HCV-infected patients.

A total of 105 sera from HCV-infected hemodialysis patients previously tested for viral hepatitis serological markers (16) were used in this study. Hemophiliac patient sera (24 hemophilia A patients) were also tested. Both hemophiliac and hemodialysis patients were defined as immunocompromised HCV-infected patients in this study. HCV-positive blood donors and other HCV-infected patients (n = 66) without any evident cause of immunosuppression were also included. Information about the genotypes of HCV circulating in 51 of these patients (17) was available: genotypes 1a, 1b, 2a, 2b, 3a, and 4 (14, 15, 8, 6, 1, and 1 patients, respectively) and six mixed infections were present in the patients analyzed. All patients were human immunodeficiency virus (HIV) negative except for one hemophiliac patient. A total of 96 sera from blood donors, negative for hepatitis B virus (HBV), HCV, and HIV markers, were also tested.

Core peptides (716 [20-mer], RNTYRRPQDVKFPGGGQIVG [amino acids {aa} 13 to 32]; 286 [40-mer], STNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRG [aa 2 to 41]), NS4 peptides (59 [20-mer], AFASRGNHVSPTHYVPESDA [aa 1920 to 1941]), and NS5 peptides (290 [35-mer], RKFPPALPIWARPDYNPPLLESWKDPDYVPPVVHG [aa 2279 to 2313]) were manually synthesized (9, 13) and were based on the consensus sequence of the HCV database (14). The immunodominant antigenic region NS3f (2) was modeled with long peptides (aa 1359 to 1408, 50-mer; aa 1409 to 1448, 40-mer; aa 1449 to 1488, 40-mer), but no significant reactivity was obtained (data not shown). All peptides were synthesized as monomers and polymers, as previously described (15).

Antibody reactivity to the peptides was tested by enzyme immunoassay, as previously described (5). Whether tested singly or as a mixture, 1 µg of each peptide was adsorbed to wells. Human sera were tested at a 1/40 dilution in 1% skim milk in phosphate-buffered saline by using for detection a 10-5 dilution of peroxidase-labelled goat anti-human immunoglobulin G (IgG) (Kirkegaard & Perry Laboratories, Gaithersburg, Md.) in the same buffer. Subclass-specific antibodies to each peptide were tested at the same serum dilution by using anti-isotype-specific monoclonal antibodies conjugated to biotin (Sigma Chemical Co., St. Louis, Mo.), each at a pretested optimal dilution, and streptavidin-peroxidase (1/1,000) (Sigma). TMB (3,3',5,5'-tetramethylbenzidine) (Bio-Rad Laboratories) was used as a substrate. Cutoff values were determined as means of negative serum values plus 3 standard deviations. Statistical differences were evaluated by the chi square and/or Fisher exact test with Yates' correction, according to a computerized Epi Info program, version 5.01b (Centers for Disease Control and Prevention, Atlanta, Ga.). Average statistical differences were evaluated by the Student t test.

The antibody reactivity to a 40-mer peptide (peptide 286) designed from the N-terminal region of the HCV core protein was significantly higher than that directed to a 20-mer peptide (peptide 716) derived from a region located inside the 40-mer peptide and previously found to be the most frequently recognized in this region (5). Of 35 hemodialysis patient sera tested, 31 (89%) recognized peptide 286 while only 24 (69%) reacted with peptide 716, and a significantly higher optical density (OD) was observed for 14 patients with peptide 286 (Table 1). The use of longer peptides in the core region has previously been suggested by others to be more effective (21). In the region shared by the two peptides, an amino acid change was introduced in the 40-mer peptide, 286, since it was more frequently found in the sequences of the different HCV isolates; this may have contributed to the increased reactivity observed with peptide 286. The length and conservation of peptide 286 ensured appropriate reactivity of sera of patients infected with all of the genotypes tested in this study (data not shown).

                              
View this table:
[in this window]
[in a new window]
 
TABLE 1.   Enhanced reactivity to a 40-mer core peptide by HCV-infected hemodialysis patient sera (n = 35)

No significant increase in reactivity was detected by using polymeric peptides instead of monomers (data not shown). When a mixture of peptides 286, 59, and 290, derived from the core, NS4, and NS5, respectively, was evaluated as a potential diagnostic antigen for HCV infection, high sensitivity and specificity were obtained with immunocompetent patients (66 of 66 patients recognized [100%] and 1 of 96 reactive among negative patient sera [99% specificity]). The mixture, however, was recognized by only 91% of the immunocompromised HCV-infected patients (118 of 129). The presence of an NS3 antigen in the cocktail used may be critical for adequate recognition of this particular group of patients (3-5). Nevertheless, the peptide cocktail analyzed in this study seems to be useful for epidemiological studies in the general population.

The NS5 region was included, as it has been suggested that the use of NS5 antigens may add sensitivity to diagnostic tests (20). In fact, some HCV-infected hemodialysis patient sera from the group studied by Devesa et al. (5) reacted only with peptide 232 from the NS5 region, which is comprised in peptide 290 used in this study (data not shown). A small portion of the 290 peptide is well conserved among different HCV isolates (aa 2288 to 2297). This might explain the frequent recognition of peptide 290 by the sera of patients tested in this study, irrespective of the infecting genotype (data not shown).

The 20-mer peptide derived from NS4 (peptide 59) and included in the cocktail contains a sequence highly conserved among different HCV isolates, which might be one of the reasons for its high frequency of recognition (5, 10, 11). Antibodies against peptide 59 seem to be raised at early stages of infection, with some degree of antigenic cross-reactivity with proteins from different origins (24). In our study, the use of peptide 59 in the cocktail did not produce nonspecific reactions. The only false-positive result was due to recognition of the core peptide, where some nonspecific reaction has also been described (23).

The antibody subclass reactivity was assayed for each of the three peptides from the core, NS4, and NS5. For the latter two peptides, the isotypic reactivity was mostly of the IgG1 subtype, a reactivity similar to that observed in region NS4a (20, 25). No significant differences were found in the isotypic reactivities between immunocompetent and immunocompromised patients (data not shown). Only in two hemodialysis patient sera was the highest reactivity, to both NS4 and NS5 peptides, of the IgG3 subclass (data not shown).

For the core peptide, IgG1 reactivity was observed in all patients. Antibodies of IgG3, IgG4, and/or IgA were found in 44% of immunocompetent HCV-infected patients but in significantly fewer immunocompromised patients, particularly in HBV-infected patients (Table 2). Reactivity to the core region has previously been shown to be predominantly by IgG1 antibodies, although all other isotypes, particularly IgG3, have been detected (6, 19, 22). A similar pattern was found for the 40-mer peptide 286, although IgG3 and IgG4 were present at similar frequencies (Table 2).

                              
View this table:
[in this window]
[in a new window]
 
TABLE 2.   Isotype reactivity to HCV peptides

The intrinsic immune deficit in hemodialysis patients has already been described (7), and acquired immune impairment has been reported for hemophiliac patients (1, 12). The restricted isotypic response to peptide 286 in both hemodialysis and hemophiliac patients may be due to some degree of impairment of the immune function. Among hemodialysis patients, this effect was more pronounced in HBV-coinfected patients, who were indeed the group with more-reduced reactivity to HCV peptides (5). These results stress the need for highly sensitive diagnostic tools for immunocompromised patients.


    ACKNOWLEDGMENTS

This work was supported by grant S1-96000064 from CONICIT, Venezuela, and by Proyecto PCEE.PNUD.VEN/96/002.


    FOOTNOTES

* Corresponding author. Mailing address: Lab. Biología de Virus, CMBC, IVIC, Apdo. 21827, Caracas 1020-A, Venezuela. Phone and fax: 58.2.504.1623. E-mail: fpujol{at}pasteur.ivic.ve.


    REFERENCES
Top
Abstract
Text
References

1. Antonace, S., E. Jirillo, D. Stassi, V. De Mitrio, M. F. La Via, and L. Bonomo. 1988. Immunoresponsiveness in hemophilia: lymphocyte- and phagocyte-mediated functions. Diagn. Clin. Immunol. 5:318-325[Medline].
2. Claeys, H., A. Volckaerts, W. Mertens, Z. Liang, P. Fiten, and G. Opdenakker. 1995. Localization and reactivity of an immunodominant domain in the NS3 region of hepatitis C virus. J. Med. Virol. 45:273-281[Medline].
3. Courouce, A.-M., N. Le Marrec, A. Girault, S. Ducamp, and N. Simon. 1994. Anti-hepatitis C virus (anti-HCV) seroconversion in patients undergoing hemodialysis: comparison of second- and third-generation anti-HCV assays. Transfusion 34:790-795[Medline].
4. Courouce, A.-M., F. Barin, C. Botté, F. Lunel, P. Maisonneuve, M. Maniez, and C. Trépo. 1995. A comparative evaluation of the sensitivity of seven anti-hepatitis C virus screening tests. Vox Sang. 69:213-216[Medline].
5. Devesa, M., Y. E. Khudyakov, F. Capriles, L. Blitz, H. A. Fields, F. Liprandi, and F. H. Pujol. 1997. Reduced antibody reactivity to hepatitis C virus antigens in hemodialysis patients coinfected with hepatitis B virus. Clin. Diagn. Lab. Immunol. 4:639-642[Abstract/Free Full Text].
6. Gabrielli, A., Z.-X. Zhang, G. Cherubi, M. Candela, S. Savoldi, A. Manzin, M. Clementi, A. Amoroso, and M. Sällberg. 1996. Differential humoral immune response against hepatitis C virus antigenic synthetic peptides in infected patients with and without mixed cryoglobulinaemia. Clin. Exp. Immunol. 105:59-64[Medline].
7. Goldblum, S. E., and W. P. Reed. 1980. Host defenses and immunological alterations associated with chronic hemodialysis. Ann. Intern. Med. 93:597-613.
8. Hosein, B., C. T. Fang, M. A. Popovsky, J. Ye, M. Zhang, and C. Y. Wang. 1991. Improved serodiagnosis of hepatitis C virus infection with synthetic peptide antigen from capsid protein. Proc. Natl. Acad. Sci. USA 88:3647-3651[Abstract/Free Full Text].
9. Houghton, R. A. 1985. Simultaneous multiple peptide synthesis. Proc. Natl. Acad. Sci. USA 82:5131-5135[Abstract/Free Full Text].
10. Khudyakov, Y. E., N. S. Khudyakova, D. L. Jue, S. B. Lambert, S. Fang, and H. A. Fields. 1995. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides. Virology 206:666-672[Medline].
11. Logombardo, G., C. Ferri, S. Marchi, F. Costa, F. Lombardini, L. Vacri, S. Bombardieri, and P. Migliorini. 1998. Immune response to an epitope of the NS4 protein of hepatitis C virus in HCV-related disorders. Clin. Immunol. Immunopathol. 87:124-129[Medline].
12. Meijer, K., W. M. Smid, S. P. Verspiek, J. W. Smit, and J. van der Meer. 1998. Differences in immune response between HCV positive, HIV negative haemophilia A and B patients. Thromb. Haemostasis 79:59-61[Medline].
13. Merrifield, R. B. 1963. Solid-phase peptide synthesis. I. The synthesis of a tetrapeptide. J. Am. Chem. Soc. 85:2149-2154.
14. Mizokami, M., T. Shin-I, and T. Gojobori. 1997. HCV data base, version 1. National Institute of Genetics, Mishima, Japan.
15. Patarroyo, M. E., R. Amador, P. Clavijo, A. Moreno, F. Guzmán, P. Romero, R. Tascón, A. Franco, L. Murillo, G. Pontón, and G. Trujillo. 1988. A synthetic vaccine protects humans against challenge with asexual blood stages of Plasmodium falciparum malaria. Nature 332:158-161[Medline].
16. Pujol, F. H., J. G. Ponce, M. G. Lema, F. Capriles, M. Devesa, F. Sirit, M. Salazar, G. Vásquez, F. Monsalve, and L. Blitz-Dorfman. 1996. High incidence of hepatitis C virus infection in hemodialysis patients in units with high prevalence. J. Clin. Microbiol. 34:1633-1636[Abstract/Free Full Text].
17. Pujol, F. H., C. L. Loureiro, M. Devesa, L. Blitz, K. Parra, S. Beker, and F. Liprandi. 1997. Determination of genotypes of hepatitis C virus from Venezuelan isolates by restriction fragment length polymorphism. J. Clin. Microbiol. 35:1870-1872[Abstract/Free Full Text].
18. Roggendorf, M., M. Lu, H. Meisel, M. Riffelmann, E. Schreier, and S. Viazov. 1996. Rational use of diagnostic tools in hepatitis C. J. Hepatol. 24(Suppl. 2):26-34[Medline].
19. Sällberg, M., U. Rudén, B. Wahren, and L. O. Magnius. 1992. Immune response to a single peptide containing an immunodominant region of hepatitis C virus core protein: the isotypes and the recognition site. Immunol. Lett. 33:27-34[Medline].
20. Sällberg, M., U. Rudén, B. Wahren, and L. O. Magnius. 1993. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site within the envelope 1 protein. Clin. Exp. Immunol. 91:489-494[Medline].
21. Sato, A., Y. Sho, H. Nakamura, T. Kunitomo, and T. Arima. 1994. Immune response of blood donors to peptides of various lengths and those with genotypic sequence variations corresponding to the N-terminal portion of the core protein of hepatitis C virus. J. Med. Virol. 44:88-91[Medline].
22. Siemoneit, K., M. da Silva Cardoso, A. Wolpl, S. Epple, H. Wintersinger, K. Koerner, and B. Kubanek. 1994. Isotype-specific immune response to a single hepatitis C virus core epitope defined by a human monoclonal antibody: diagnostic value and correlation to PCR. Ann. Hematol. 69:129-133[Medline].
23. Tobler, L. H., M. Busch, J. Peterson, R. Kochesky, C. Bahl, and S. R. Lee. 1996. Identification of a crossreactive epitope within hepatitis C virus core antigen: resolution by third-generation hepatitis C virus assays. Transfusion 36:581-582[Medline].
24. Wienhues, U., H.-G. Ihlenfeldt, C. Seidel, U. Schmitt, W. Kraas, and G. Jung. 1998. Characterization of a linear epitope in the nonstructural region 4 of hepatitis C virus with reactivity to seroconversion antibodies. Virology 245:281-288[Medline].
25. Zhang, Z.-X., M. Chen, C. Hultgren, A. Birkett, D. R. Milich, and M. Sällberg. 1997. Immune responses to the hepatitis C virus NS4A protein are profoundly influenced by the combination of the viral genotype and the host major histocompatibility complex. J. Gen. Virol. 78:2735-2746[Abstract].


Clinical and Diagnostic Laboratory Immunology, March 1999, p. 279-281, Vol. 6, No. 2
1071-412X/99/$04.00+0
Copyright © 1999, American Society for Microbiology. All rights reserved.




This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow E-mail this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Devesa, M.
Right arrow Articles by Pujol, F. H.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Devesa, M.
Right arrow Articles by Pujol, F. H.